PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G24040.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 377aa    MW: 43180.4 Da    PI: 8.9682
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G24040.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.92e-31959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  ORUFI08G24040.2  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                     79***********************************************96 PP

2K-box17.41.8e-0784114838
            K-box   8 sleeakaeslqqelakLkkeienLqreqRhl 38 
                      + e+++ + +++e+ kLk+++enLqr+qRh 
  ORUFI08G24040.2  84 NRESEQLKASRNEYLKLKARVENLQRTQRHW 114
                      467888999********************96 PP

3K-box70.26.4e-2413419935100
            K-box  35 qRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       R+llGedL+sL +keL++Le+qL++slk++R++++++l++ + elq++e++++e+n++Lr+klee
  ORUFI08G24040.2 134 DRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDRLTELQRREQMVSEANRCLRRKLEE 199
                      59*************************************************************987 PP

4K-box37.69.5e-142492823669
            K-box  36 RhllGedLesLslkeLqqLeqqLekslkkiRskK 69 
                       +llGedL+sL +keL++Le+qL++slk++R+++
  ORUFI08G24040.2 249 GNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTR 282
                      49*****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.389161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
CDDcd002654.92E-43277No hitNo description
SuperFamilySSF554551.29E-33289IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-323859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.80390203IPR002487Transcription factor, K-box
PfamPF014864.8E-18133197IPR002487Transcription factor, K-box
PROSITE profilePS512976.781227335IPR002487Transcription factor, K-box
PfamPF014861.8E-9250290IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCST  60
QSMTKTLEKY QKCSYAGPET AVQNRESEQL KASRNEYLKL KARVENLQRT QRHWKSNFHM  120
YITNTLLPLC VDYDRNLLGE DLDSLGIKEL ESLEKQLDSS LKHVRTTRTK HLVDRLTELQ  180
RREQMVSEAN RCLRRKLEES NHVRGQQVWE QGCNLIGYER QPEVQQPLHG GNGFFHPLDA  240
AGEPTLQIGN LLGEDLDSLG IKELESLEKQ LDSSLKHVRT TRWILNSDET SRRPRSPATL  300
PPPVPTPLHD RAAAQQQQQQ LARRGDGEME MVPLLLLPST TFLFFENGFP HHHIIILASS  360
TVLALLLVVL VLSSSPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D7e-22751971101Developmental protein SEPALLATA 3
4ox0_C7e-22751971101Developmental protein SEPALLATA 3
4ox0_B7e-22751971101Developmental protein SEPALLATA 3
4ox0_A7e-22751971101Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5519210.0AY551921.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS216 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648761.11e-160PREDICTED: MADS-box transcription factor 7 isoform X1
SwissprotP0C5B01e-159MADS7_ORYSI; MADS-box transcription factor 7
SwissprotQ0J4661e-159MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBLA0A0E0QLM00.0A0A0E0QLM0_ORYRU; Uncharacterized protein
STRINGLOC_Os08g41950.11e-159(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34833469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.16e-79MIKC_MADS family protein